PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00789.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 252aa    MW: 28000.7 Da    PI: 8.7393
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00789.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-163279148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEde+lv  +k+ G g+W++ +++ g+ R++k+c++rw +yl
  Rsa1.0_00789.1_g00001.1 32 RGPWTLEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 79
                             89******************************99************97 PP

2Myb_DNA-binding40.27.9e-1390130648
                              HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              ++E++l+++++++ G++ W++Ia +++ gRt++++k++++++l
  Rsa1.0_00789.1_g00001.1  90 PDEEDLILRLHRLIGNK-WSLIAGRIP-GRTDNEIKNYLNTHL 130
                              79***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-212381IPR009057Homeodomain-like
PROSITE profilePS5129422.2882783IPR017930Myb domain
SuperFamilySSF466891.09E-2728125IPR009057Homeodomain-like
SMARTSM007174.6E-133181IPR001005SANT/Myb domain
PfamPF002498.8E-153279IPR001005SANT/Myb domain
CDDcd001679.07E-123479No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2182134IPR009057Homeodomain-like
SMARTSM007173.7E-1084132IPR001005SANT/Myb domain
PROSITE profilePS5129416.76284134IPR017930Myb domain
PfamPF002491.9E-1190130IPR001005SANT/Myb domain
CDDcd001671.45E-890130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MLKTVDMTSS SGNRSVARKI TTPCCTKMGM KRGPWTLEED EILVSFIKKE GEGRWRSLPK  60
RAGLLRCGKS CRLRWMNYLR PSVKRGGIAP DEEDLILRLH RLIGNKWSLI AGRIPGRTDN  120
EIKNYLNTHL RKKLLSQGID PQTHKPLDAS NTHKPGEEVP GGQNLLEPNS SSHTDDTTVS  180
SGNGAGKISN SVFGDEDFGF CYDDKFSSFL NSVINDDPFD SNIPVLSQPL QTRDFIVGTS  240
SSLGHDQIPK DM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24321347108B-MYB
1h8a_C3e-243013425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195871e-139AY519587.1 Arabidopsis thaliana MYB transcription factor (At3g13540) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640045.11e-171PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-133MYB5_ARATH; Transcription repressor MYB5
TrEMBLM4EF611e-171M4EF61_BRARP; Uncharacterized protein
STRINGBra027423.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-124myb domain protein 5